Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G043700.2.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 820aa    MW: 88406.2 Da    PI: 5.6912
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G043700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe+lF+++++p++++r eL+++l L+ rqVk+WFqNrR+++k
                        688999***********************************************999 PP

              START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        ela++a++elvk+a+ +ep+W+  +   e +n++e+++ f++  +     + +ea r++g+v+ +++ lve+l+d + +W e+++    + +
                        5899**************************************999999*9***************************.************** PP

              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        t +vi sg      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd +++ p+s+ +v +++lpSg+++++++ng+skv+
                        ******************************************************************************************** PP

              START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        wveh++++++++h l+r+l++ g+ +ga++wvatl+rqce+
                        ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.297114174IPR001356Homeobox domain
SMARTSM003899.7E-17115178IPR001356Homeobox domain
CDDcd000863.83E-18116174No hitNo description
PfamPF000461.2E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084843.961315550IPR002913START domain
SuperFamilySSF559612.7E-34317547No hitNo description
CDDcd088752.76E-123319546No hitNo description
PfamPF018522.4E-56324547IPR002913START domain
SMARTSM002341.8E-47324547IPR002913START domain
Gene3DG3DSA:3.30.530.201.4E-5380523IPR023393START-like domain
SuperFamilySSF559613.18E-25574744No hitNo description
SuperFamilySSF559613.18E-25772812No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661562.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLF6I3160.0F6I316_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein